Pseudomonas stutzeri ferredoxin: close similarity to Azotobacter vinelandii and Pseudomonas ovalis ferredoxins.

Pseudomonas stutzeri ferredoxin: close similarity to Azotobacter vinelandii and Pseudomonas ovalis ferredoxins. Research Abstract Details 

Research Abstract Table of Contents

Jump to the:

Pseudomonas stutzeri ferredoxin: close similarity to Azotobacter vinelandii and Pseudomonas ovalis ferredoxins. Abstract Text:

K Saeki,S Wakabayashi,W G Zumft,H Matsubara,

The complete primary structure of Pseudomonas stutzeri strain ZoBell ferredoxin was determined by a combination of protease digestion, Edman degradation, and carboxypeptidase digestion and was: TFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIH PDECIDCALCEPECPAQAIFSEDEVPEDQQEFIELNADLAEVWPNITE KKDALADAEEWDGVKDKLQYLER. The calculated molecular weight was 12,110 excluding iron and sulfur atoms. The amino acid sequence was highly homologous to those of Azotobacter vinelandii and Pseudomonas ovalis ferredoxins. It showed, like the other two, a Tyr-Thr insertion between the second and third Cys, and extra Cys at position 24 and, compared to Clostridium- and Bacillus-type ferredoxins, an extended C-terminal sequence.

Pseudomonas stutzeri ferredoxin: close similarity to Azotobacter vinelandii and Pseudomonas ovalis ferredoxins. Publishing Authors By Initials

K Saeki,S Wakabayashi,WG Zumft,H Matsubara,

For similar bacteria: gram-positive bacteria: gram-positive cocci: staphylococcaceae: staphylococcus research abstracts see: bacteria: gram-positive bacteria: gram-positive cocci: staphylococcaceae: staphylococcus research

PUBMED ID PMID:

MEDLINE DATE:

Pseudomonas stutzeri ferredoxin: close similarity to Azotobacter vinelandii and Pseudomonas ovalis ferredoxins. Journal Published:

PUBLICATION TYPE: Research Support, Non-U.S. Gov

Journal: Journal of biochemistry

VOLUME: 104

Page Numbers: 242-6

Journal Abbreviation: J. Biochem.

ISSN: 0021-924X

DAY: 19

MONTH: Aug

YEAR: 1988

Pseudomonas stutzeri ferredoxin: close similarity to Azotobacter vinelandii and Pseudomonas ovalis ferredoxins. Information

Number of References:

LANGUAGE: eng

NlmUniqueID: 376600

Pseudomonas stutzeri ferredoxin: close similarity to Azotobacter vinelandii and Pseudomonas ovalis ferredoxins. Keywords Mesh Terms:

KEYWORDS: Staphylococcus

MESH TERMS: enzymology

Chemical & Substance for Abstract: Pseudomonas stutzeri ferredoxin: close similarity to Azotobacter vinelandii and Pseudomonas ovalis ferredoxins. Information

Substance Name: Chymotrypsin

Registry Number: EC 3.4.21.1

Grant and Affiliation Information for Pseudomonas stutzeri ferredoxin: close similarity to Azotobacter vinelandii and Pseudomonas ovalis ferredoxins.

AFFILIATION: Department of Biology, Faculty of Science, Osaka University.

Country: JAPAN

AGENCY:

GRANT:

ACRONYM:

MEDLINETA: J Biochem

REFSOURCE:

DATABASENAME:

ACCESSION NUMBER:

Number Hits: 0

Pseudomonas stutzeri ferredoxin: close similarity to Azotobacter vinelandii and Pseudomonas ovalis ferredoxins Related Publications

• A case report of mycobacterium abscessus peritonitis in a peritoneal dialysis patient.
• A charge-transfer complex of 10,10'-dihydroxy-9,9'-biphenanthryl and methylviologen as a visual inclusion host system.
• A minor component of ferredoxin from Aphanothece sacrum cells.
• A nitrite reductase from Achromobacter cycloclastes.
• Actinin-4 expression in ovarian cancer: a novel prognostic indicator independent of clinical stage and histological type.
• Amino acid sequence of Aphanothece sacrum Ferredoxin II (minor component). Structural characteristics and evolutionary implications.
• Amino acid sequence of the major component of Aphanothece sacrum ferredoxin.
• Amino acid sequence of the major component of Nostoc muscorum ferredoxin.
• Biochemical studies on marine shellfish lipid. II. Glycolipid of oyster mantle.
• Chemical modification of spinach ferredoxin. Properties of acetylated spinach ferredoxin.
• Chemo-, regio- and stereoselective preparation of silyl enol ethers from thiol esters and bis(iodozincio)alkane.
• Crystallization and a 5 A X-ray diffraction study of Aphanothece sacrum ferredoxin.
• Cytochrome c-557 (551) and cytochrome cd of Alcaligenes faecalis.
• Evolutionary information involved in primary structures of chloroplast-type ferredoxins.
• Ferredoxin from a blue-green alga, Aphanothece sacrum (Suringar) Okada.
• Growth and Production of Steroid Saponin in Solanum aculeatissimum During One Vegetation Period.
• Horsetail (Equisetum arvense) ferredoxins I and II Amino acid sequences and gene duplication.
• Horsetail (Equisetum telmateia) ferredoxins I and II. Amino acid sequences.
• Horsetail ferredoxin: isolation and some chemical studies.
• Isolation and characterization of two ferredoxin-NADP+ reductases from Spirulina platensis.
• Microsatellite instability and clinicopathological features in esophageal squamous cell cancer.
• Multi-component orbital interactions during oxyacyl radical addition reactions involving imines and electron-rich olefins.
• Purification and some properties of Achromobacter cycloclastes azurin.
• Salvage surgery for esophageal carcinoma after definitive chemoradiation therapy.
• Studies on denitrification. 8. Some properties of the N2O-anaerobically grown cell.
• Studies on denitrification. XII. Gas production from amines and nitrite.
• The participation of cytochromes in the reduction of N20 to N2 by a denitryfying bacterium.
• Usefulness of ultrasonography in carotid arteries and combined positron emission tomography/ computed tomography for diagnosis of Takayasu arteritis with unusual presentation as acute myocardial infarction: a case report.
• Ventricular systolic reserve in asymptomatic children previously treated with low doses of anthracyclines.
• X-ray analysis of ferredoxin from Spirulina platensis. II. Chelate structure of active center.