		Molecular Biology Forum Life Science Forums > Tags
Threads Tagged with present

present Forum

FAQ Questions and present Troubleshooting

present

Threads Tagged with present
	Thread / Thread Starter	Last Post	Replies	Views	Forum
	CKDDVFTHLYTLIVKPDNTYQVKIDNEVVEKGELEK . How many peptide bonds are present C M	09-04-2009 05:06 PM by sanda	2	114	Peptide Forum
	How do you identify the anitmicrobial peptide present in the skin gland... carm	08-30-2009 08:17 PM by carm	0	63	Peptide Forum
	A chemical formula ised to show the number and types of atoms present in a molecule Luke T	07-09-2009 12:17 AM by Luke T	0	100	Chemistry Forum
	significant technological breakthroughs from 1900 to the present? Kagome	06-27-2009 06:20 PM by icedu789	3	227	Physics Forum
	Involuntary and not striated muscle fibers are present in the? john	06-25-2009 12:16 PM by Steven	2	17	Biology Forum
	Identify the most important types of interparticle forces present in the following... chemy girl	06-23-2009 03:16 PM by chemy girl	0	24	Chemistry Forum
	When the el nino current was present, there was a drought however, it wasn 8454	06-23-2009 09:18 AM by Jackie chan	1	20	Environmental Sciences and Issues
	A peptide bond is present in ? LADY ENYCE	06-17-2009 10:25 PM by sanda	2	91	Peptide Forum
	X-ray Spectrometry Proves Thermite Present in WTC Debris aaaaaaaadftdfgdfgdfgdfgdgdf@googlemail.com	09-13-2007 06:16 AM by aaaaaaaadftdfgdfgdfgdfgdgdf@googlemail.com	0	21	Physics Forum
	X-ray Spectrometry Proves Thermite Present in WTC Debris aaaaaaaadftdfgdfgdfgdfgdgdf@googlemail.com	09-13-2007 06:16 AM by aaaaaaaadftdfgdfgdfgdfgdgdf@googlemail.com	0	22	Physics Forum
	X-ray Spectrometry Proves Thermite Present in WTC Debris Mexico	09-13-2007 03:18 AM by Mexico	0	10	Physics Forum
	X-ray Spectrometry Proves Thermite Present in WTC Debris Mexico	09-13-2007 03:18 AM by Mexico	0	13	Physics Forum
	Past, present and future of E=mc2: A CRITICAL DISCUSSION AJAY SHARMA	10-24-2006 10:31 AM by AJAY SHARMA	0	29	Physics Forum
	The First to Present a Complete Mathematical Formulation of Spacetime Perspicacious	08-28-2005 02:07 AM by Eugene Shubert	6	7	Physics Forum
	How to present microarray data in a talk? Peter Frank	02-23-2005 12:07 PM by Dr Engelbert Buxbaum	3	188	Protocols and Methods Forum
	Spreading oil onto skin with water present Vance Roos	09-26-2003 01:47 PM by Vance Roos	0	15	Chemistry Forum
	Spreading oil onto skin with water present Vance Roos	09-26-2003 01:47 PM by Vance Roos	0	14	Physics Forum
	Oil lubrication with detergent present Vance Roos	09-04-2003 08:05 PM by Uncle Al	3	10	Physics Forum

All times are GMT. The time now is 08:22 AM.

Member Login

present Forum

FAQ Questions and present Troubleshooting

present