		Molecular Biology Forum Life Science Forums > Tags
Threads Tagged with bonds

Science Groups New!

Mark Forums Read

bonds Forum

FAQ Questions and bonds Troubleshooting

bonds

Page 1 of 2

1

Threads Tagged with bonds
		Thread / Thread Starter	Last Post	Replies	Views	Forum
		How many peptide bonds in this protein molecule? Tallulah	11-09-2009 08:44 AM by nanofreak	1	57	Peptide Forum
		How many peptide bonds does GLUT1 have? shiraishi122	11-06-2009 11:58 PM by nanofreak	1	77	Peptide Forum
		War bonds lighters World war two lighters hafool123	10-27-2009 06:52 AM by aje00325	2	228	Science Careers
		why does chymotrypsin and trypsin break peptide bonds between different amino acids? James	10-07-2009 03:09 AM by nanofreak	3	405	Peptide Forum
		Serine linked with peptide bonds? Jon	10-01-2009 09:17 PM by sci219	1	64	Peptide Forum
		peptide bonds hold together what kinds of molecules? Bre	09-26-2009 03:20 AM by nanofreak	2	106	Peptide Forum
		If a protein contained 200 peptide bonds, how many molecules of water do Anderson W	09-17-2009 01:04 AM by nanofreak	3	164	Peptide Forum
		CKDDVFTHLYTLIVKPDNTYQVKIDNEVVEKGELEK . How many peptide bonds are present C M	09-04-2009 05:06 PM by sanda	2	114	Peptide Forum
		What are ionic, covalent, and peptide bonds? imad	08-25-2009 10:17 PM by imad	0	72	Peptide Forum
		So if there are 199 amino acids in a protein, how many peptide bonds would there be? zemps22	08-25-2009 05:07 AM by sanda	1	97	Peptide Forum
		The cleaving of peptide bonds is performed by proteins called........? Baptiste	08-04-2009 03:29 PM by sanda	1	55	Peptide Forum
		why are peptide bonds planar and rigid? harajukuxlover	08-03-2009 02:21 AM by Jaradal	1	149	Peptide Forum
		Of proteins and peptide bonds.? ohsnap	07-01-2009 03:16 PM by sanda	2	82	Peptide Forum
		can any one name the properties of minerals that depend on chemical bonds? Star	06-29-2009 01:21 AM by sd3r	2	108	Environmental Sciences and Issues
		Does Saturated Fats have a maximum number of C-H bonds? becky	06-25-2009 05:19 AM by becky	0	11	Biology Forum
		what do the double slashed bonds mean in a chemical structure diagram? No-uhh.	06-10-2009 12:17 PM by eric	4	38	Chemistry Forum
		Amino Acids Combined By Peptide Bonds? Mike	10-24-2008 05:16 PM by Mike	0	447	Peptide Forum
		Protein Disulfide Bonds and Fixation of Tissues in Histology? dave2006	07-04-2008 10:13 AM by dave2006	0	342	Histology Forum
		methods of breaking disulphide bonds Deitiker, Philip R	04-23-2008 06:26 PM by Deitiker, Philip R	0	102	Protocols and Methods Forum
		Books for bonds Paulo Hendler	10-17-2006 01:22 PM by Paulo Hendler	0	18	Organic Chemistry Forum

Page 1 of 2

1

All times are GMT. The time now is 11:12 PM.