Go Back   Science Forums Biology Forum Molecular Biology Forum Physics Chemistry Forum > Molecular Research Topics Forum > Protein Science > Protein Forum
Register Search Today's Posts Mark Forums Read

Protein Forum Protein Forum


3D-Match and 3D-MatchDB FAST Structural alignment on line

3D-Match and 3D-MatchDB FAST Structural alignment on line - Protein Forum

3D-Match and 3D-MatchDB FAST Structural alignment on line - Protein Forum


Reply
 
LinkBack Thread Tools Display Modes
  #1  
Old 03-20-2006, 11:37 PM
webmaster@softberry.com
Guest
 
Posts: n/a
Default 3D-Match and 3D-MatchDB FAST Structural alignment on line



3D-Match: Alignment 3D structures of two proteins and
3D-MatchDB: - FAST on-line search of nonredundant PDB for structural
homology with a query protein.

The new programs are available for public use at

[Only registered users see links. ]

Comparison of 500 structural alignments produced by CE and 3D-Match reveals
that
average RMSD of results produced by CE is by 0.13 angstrom lower,
but alignments by 3D-Match are on average 5.03 residues longer.

It takes 3DMatchDB just a few minutes to search nonredundant PDB database
(12,834 proteins with less than 98% sequence similarity) for structural
homologs
with a given 3D structure.
To increase speed, 3DmatchDB uses an algorithm of fast alignment of
secondary structure elements (helix, beta-sheet) and a preprocessed PDB
database that
has protein secondary structure elements mapped to 3D structures.
3DMatchDB performs pairwise structural alignment of a query protein with
each database entry, and calculates RMSD and Zscore for each pair.

An example of 3DMATCH output:
===================================

HEADER PROTEIN STRUCTURE ALIGNMENT
COMPND (A) 1BWW chain A (B) 2BFV chain L
REMARK 1
REMARK 1 RMSD on Ca-atoms : 0.817 angstrom
REMARK 1 Zscore : 6.230
REMARK 1 Aligned positions: 107
REMARK 1 Gap positions : 5
REMARK 1 Sequence identity: 54.5 (%)
REMARK 1
REMARK 1 Structure based sequence alignment
REMARK 1
REMARK 1 3 DIQMTQSPSSLSASVGDRVTITCQASQDII-----KYLNWYQQKPGKAPKLLIYEASNLQ
REMARK 1 1 DIELTQSPPSLPVSLGDQVSISCRSSQSLVSNNRRNYLHWYLQKPGQSPK LVIYKVSNRF
REMARK 1
REMARK 1 58 AGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQYQSLPYTFGQGTKLQ IT
REMARK 1 61 SGVPDRFSGSGSGTDFTLKISRVAAEDLGLYFCSQSSHVPLTFGSGTKLE IK
REMARK 1
ATOM 1 N THR A 1 -19.249 5.700 -17.692 1.00 67.85 N
ATOM 2 CA THR A 1 -18.745 6.056 -16.364 1.00 64.75 C
ATOM 3 C THR A 1 -17.224 6.135 -16.364 1.00 48.48 C
ATOM 4 O THR A 1 -16.538 5.185 -16.770 1.00 47.02 O
ATOM 5 CB THR A 1 -19.208 5.088 -15.261 1.00 72.33 C
ATOM 6 OG1 THR A 1 -20.156 4.118 -15.725 1.00 76.14 O



An example of 3DMATCH-DB output:
===================================
STRUCTURE DATABASE SEARCHING.

ID ZScore RMSD Aligned Size Gaps Name
1SEM:A 5.7 0.00 9 11 0 MOLECULE: SEM-5; DOMAIN: C-TERMINAL SH3, RESIDUES 155-
214; CHAIN: A, B;
1QKW:A 5.3 0.63 9 11 0 MOL_ID: 1; MOLECULE: ALPHA II SPECTRIN; CHAIN: A;
FRAGMENT: SH3 DOMAIN;
1QKX:A 5.3 0.62 9 11 0 MOL_ID: 1; MOLECULE: SPECTRIN ALPHA CHAIN; CHAIN: A;
FRAGMENT: SH3 DOMAIN
1NG2:A 5.3 0.65 9 25 0 MOL_ID: 1; MOLECULE: NEUTROPHIL CYTOSOLIC FACTOR 1;
CHAIN: A; FRAGMENT:
1K76:A 5.3 0.59 9 11 0 MOL_ID: 1; MOLECULE: SEX MUSCLE ABNORMAL PROTEIN 5;
CHAIN: A; FRAGMENT:
1GCQ:A 5.2 0.77 9 11 0 MOL_ID: 1; MOLECULE: GROWTH FACTOR RECEPTOR-BOUND
PROTEIN 2; CHAIN: A, B;
1HD3:A 5.2 0.83 9 11 0 MOL_ID: 1; MOLECULE: SPECTRIN ALPHA CHAIN; CHAIN: A;
FRAGMENT: SH3-DOMAIN
1QCF:A 5.2 0.81 9 69 0 MOL_ID: 1; MOLECULE: HAEMATOPOETIC CELL KINASE (HCK);
CHAIN: A; FRAGMENT:
1UUE:A 5.2 0.81 9 11 0 MOL_ID: 1; MOLECULE: SPECTRIN ALPHA CHAIN; SYNONYM:
SPECTRIN NON-
1E6H:A 5.2 0.70 9 11 0 MOL_ID: 1; MOLECULE: SPECTRIN ALPHA CHAIN; CHAIN: A;
FRAGMENT: SH3-DOMAIN
1JO8:A 5.0 1.01 9 11 0 MOL_ID: 1; MOLECULE: ACTIN BINDING PROTEIN; CHAIN: A;
FRAGMENT: SH3
1JEG:A 5.0 1.01 9 11 0 MOL_ID: 1; MOLECULE: TYROSINE-PROTEIN KINASE CSK;
CHAIN: A; FRAGMENT: SH3
1E6G:A 5.0 0.93 9 11 0 MOL_ID: 1; MOLECULE: SPECTRIN ALPHA CHAIN; CHAIN: A;
FRAGMENT: SH3-DOMAIN
1SHF:A 5.0 1.02 9 11 0 FYN PROTO-ONCOGENE TYROSINE KINASE (E.C.2.7.1.112)
(SH3 DOMAIN)
1EFN:A 4.9 1.21 9 11 0 MOL_ID: 1; MOLECULE: FYN TYROSINE KINASE; CHAIN: A, C;
FRAGMENT: SH3
1UGV:A 4.7 1.41 9 11 0 MOL_ID: 1; MOLECULE: OLYGOPHRENIN-1 LIKE PROTEIN;
CHAIN: A; FRAGMENT: SH3
1BBZ:A 4.7 1.41 9 11 0 MOL_ID: 1; MOLECULE: ABL TYROSINE KINASE; CHAIN: A, C,
E, G; FRAGMENT:
1YCS:B 4.7 1.26 9 28 0 MOL_ID: 1; MOLECULE: P53; CHAIN: A; FRAGMENT: RESIDUES
97 - 287;
1GL5:A 4.7 1.32 9 10 0 MOL_ID: 1; MOLECULE: TYROSINE-PROTEIN KINASE TEC;
CHAIN: A; FRAGMENT: SH3
1UJ0:A 4.7 1.37 9 10 0 MOL_ID: 1; MOLECULE: SIGNAL TRANSDUCING ADAPTOR
MOLECULE (SH3 DOMAIN AND
1BBZ:E 4.6 1.45 9 11 0 MOL_ID: 1; MOLECULE: ABL TYROSINE KINASE; CHAIN: A, C,
E, G; FRAGMENT:
1H92:A 4.4 0.81 6 11 0 MOL_ID: 1; MOLECULE: PROTO-ONCOGENE TYROSINE-PROTEIN
KINASE LCK; CHAIN:
.................................................. .....

For each found homolo, a structural alignment can be output:

PROTEIN STRUCTURE ALIGNMENT.

HEADER PROTEIN STRUCTURE ALIGNMENT
COMPND (A) 1SEM chain A (B) 1YCS chain B
REMARK 1
REMARK 1 RMSD on Ca-atoms: 1.084 angstrom
REMARK 1 Zscore : 4.890
REMARK 1
REMARK 1
REMARK 1 Alignment
REMARK 1
REMARK 1 156 TKFVQALFDFNPQESGELAFKRGDVITLINKD---DPNWWEGQLNNRRGIFPSNYVCPY
REMARK 1 460 KGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGY VPRNLLGLY
REMARK 1
ATOM 1 N GLU A 155 10.819 -4.205 14.117 1.00 57.62 1SEM
139
ATOM 2 CA GLU A 155 9.614 -5.059 13.924 1.00 55.34 1SEM
140
ATOM 3 C GLU A 155 9.081 -4.788 12.519 1.00 49.05 1SEM
141
ATOM 4 O GLU A 155 9.313 -3.718 11.961 1.00 49.97 1SEM
142

Reply With Quote
Reply

Tags
3dmatch , 3dmatchdb , alignment , fast , line , structural


Thread Tools
Display Modes

Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts

BB code is On
Smilies are On
[IMG] code is On
HTML code is Off
Trackbacks are On
Pingbacks are On
Refbacks are On

Forum Jump

Similar Threads
Thread Thread Starter Forum Replies Last Post
Human Cytome Project - Update 24 Jan. 2005 Peter Van Osta Cell Biology and Cell Culture 1 08-01-2010 02:18 PM
Human Cytome Project - Update 6 Jan. 2005 Peter Van Osta Cell Biology and Cell Culture 0 01-06-2005 11:18 AM


All times are GMT. The time now is 08:11 AM.


Powered by vBulletin® Version 3.8.4
Copyright ©2000 - 2014, Jelsoft Enterprises Ltd.
Copyright 2005 - 2012 Molecular Station | All Rights Reserved
Page generated in 0.15797 seconds with 16 queries