Is Gastric Inhibitory Peptide and Enterogastrone the same thing?

Basketball Fan88 · #1 (**permalink**) 06-08-2009, 11:38 AM

They both have similar definitions in two books but a little different
entergastrone is a hormone which in presence of fatty chyme in the duodenum results in the inhibition of stomach peristalsis
Gastric inhibitory protein in response to fat and protein digestates results in the decreases stomach motor activity

glbiochem · #2 (**permalink**) 06-15-2009, 07:01 AM

Here is the sequence of
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
55416 Gastric Inhibitory Peptide (GIP), human

GL Biochem has it.

Best Wish,

Mr. David Wei
Senior Sales Manager

GL Biochem(Shanghai) Ltd.
519 Ziyue Road, Minhang
Shanghai,200241
PR China

Mobile: 0086-15301650007(24 hour)
Tel: 0086-21-61263307
Fax: 0086-21-61263399
Website: [Only registered users see links. ]
E-mail: [Only registered users see links. ]

2009-06-15
14:01:21

Thread Tools
Show Printable Version Email this Page
Display Modes
Linear Mode Switch to Hybrid Mode Switch to Threaded Mode

Member Login

Is Gastric Inhibitory Peptide and Enterogastrone the same thing?

Is Gastric Inhibitory Peptide and Enterogastrone the same thing? - Peptide Forum

Is Gastric Inhibitory Peptide and Enterogastrone the same thing? - Peptide Forum. Ask and discuss questions on peptide protocols, custom peptide synthesis, peptide identification and peptide sequencing.