Go Back   Science Forums Biology Forum Molecular Biology Forum Physics Chemistry Forum > Molecular Research Topics Forum > PCR - Polymerase Chain Reaction Forum
Register Search Today's Posts Mark Forums Read

PCR - Polymerase Chain Reaction Forum PCR - Polymerase Chain Reaction Forum. Discuss and ask questions about PCR troubleshooting, PCR protocols and methods, PCR products, and PCR theory.


Primer Design

Primer Design - PCR - Polymerase Chain Reaction Forum

Primer Design - PCR - Polymerase Chain Reaction Forum. Discuss and ask questions about PCR troubleshooting, PCR protocols and methods, PCR products, and PCR theory.


Reply
 
LinkBack Thread Tools Display Modes
  #1  
Old 10-04-2010, 01:51 PM
Pipette Filler
Points: 689, Level: 13 Points: 689, Level: 13 Points: 689, Level: 13
Activity: 0% Activity: 0% Activity: 0%
 
Join Date: Sep 2010
Posts: 21
Thanks: 1
Thanked 0 Times in 0 Posts
Default Primer Design



I am trying to amplify a region for a strain tht has not been sequenced so far.
I designed primers using the the sequence information of the conserved domain.
The size of my amplicon expected is around 600bp. But, I was only able to amplify a 200bp product.

The region tht was conserved was around the region between 120-480 bp.

Can anyone suggest any other ways to design the primers ?

thnx!
Reply With Quote
  #2  
Old 10-07-2010, 09:35 PM
Pipette Filler
Points: 580, Level: 11 Points: 580, Level: 11 Points: 580, Level: 11
Activity: 0% Activity: 0% Activity: 0%
 
Join Date: Sep 2010
Location: Buenos Aires, Argentina
Posts: 7
Thanks: 0
Thanked 2 Times in 2 Posts
Default Re: Primer Design

Maybe you could design your primers inside the region that is well conserved, instead of using flanking regions?
What´s your departure material? gDNA? cDNA?
Is it a bacterial, yeast or viral gene you are trying to catch?
Reply With Quote
  #3  
Old 10-08-2010, 01:42 AM
Pipette Filler
Points: 689, Level: 13 Points: 689, Level: 13 Points: 689, Level: 13
Activity: 0% Activity: 0% Activity: 0%
 
Join Date: Sep 2010
Posts: 21
Thanks: 1
Thanked 0 Times in 0 Posts
Default Re: Primer Design

I used gDNA as my template and used the inside region which was well conserved.
It is a bacterial gene I am trying to catch.I have highlighted the conserved regions I used for my Forward and Reverse primer design.
I am lost; any thoughts how how to get the complete gene amplified?


gi 50593059 13 ARTKAIETLLYERGLITPAAVDRVVSYYENEIGPMGGAKVVAKSWVDPEYRKWLEEDATAAMASLGYAGEQAHQISAVFN 92
Cdd:TIGR01323 1 ARAKALEQVLKSKGLIPEGAVDQLTSLYENEWGPENGAKVVAKAWVDPEFRALLLKDATAACAQFGYTGPQGEYIVALEN 80

90 100 110 120 130 140 150 160
....*....|....*....|....*....|....*....|....*....| ....*....|....*....|....*....|
gi 50593059 93 DSQTHHVVVCTLCSCYPWPVLGLPPAWYKSMEYRSRVVADPRGVLkRDFG FDIPDEVEVRVWDSSSEIRYIVIPERPAGT 172
Cdd:TIGR01323 81 TPGVHNVVVCTLCSCYPWPVLGLPPEWYKGFEYRARLVRDPRGVL-REFGTELPSDVEIRVWDSSAESRYLVLPQRPAGT 159

170 180
....*....|....*....|....*.
gi 50593059 173 DGWSEDELAKLVSRDSMIGVSNALTP 198
Cdd:TIGR01323 160 EHMSEEQLQQLVTRDSLIGVSLPRTP 185
Reply With Quote
  #4  
Old 10-08-2010, 06:06 PM
Pipette Filler
Points: 580, Level: 11 Points: 580, Level: 11 Points: 580, Level: 11
Activity: 0% Activity: 0% Activity: 0%
 
Join Date: Sep 2010
Location: Buenos Aires, Argentina
Posts: 7
Thanks: 0
Thanked 2 Times in 2 Posts
Default Re: Primer Design

OK. According to the sequence you pasted, your amplicon should be around 372 bp (124 aminoacids*3), so I´m confused about you saying you should expect a 600 bp amplicon?
Besides, now I see you are using degenerate primers (and since you lack nucleotide sequence info, these are REALLY degenerate). That could explain why you are getting an unexpected amplicon: it could be due to a simple mispriming.

Several strategies could help in minimizing off-target amplification. These are:
  1. "Hot-start" (keeping your tubes in ice, and placing them in the cycler block only after it has reached >80 degrees celsius).
  2. Raising your annealing temperature (Tann) an empirical number of degrees (2-5), or
  3. A "touch-down" protocol (starting with an annealing temperature which is ten degrees above your normal Tann, and lowering one degree per cycle through ten cycles (consult your cycler manual or brochure to do this) before letting the rest of the program cycle using the usual Tann.

Alternatively, you can redesign your primers.

The 3´end of your forward primer looks quite nice. A lysine in the 3´end is a good deal: only two possible codons coding for it (i.e. fewer degeneration). But I still would have continued to the tryptophan (only one possible codon) to enhance specificity. Thus, the sequence to add to the 3´end of your current forward primer would be: DSIUGG (Ser/Ala + Trp). I think this could enhance your primer specificity a lot.
With respect to the reverse primer, it looks like you´ve chosen many aminoacids with wide codon redundance. This greatly hampers your primer specificity.

I would use the following region to design a reverse primer:

gi 50593059 175 WSEDEL
Cdd:TIGR01323 172 MSEEQL

The REVERSE primer thus being:

5´-IARRTSITCYTCISWCKW-3´

I hope this helps at least a little.
Good luck with your experiments.
Reply With Quote
  #5  
Old 10-24-2010, 12:26 PM
Pipette Filler
Points: 689, Level: 13 Points: 689, Level: 13 Points: 689, Level: 13
Activity: 0% Activity: 0% Activity: 0%
 
Join Date: Sep 2010
Posts: 21
Thanks: 1
Thanked 0 Times in 0 Posts
Default Re: Primer Design

HI Irideus,
Thank u very much. Sorry to get back late to ur posts though...
will surely keep u updated.
Reply With Quote
  #6  
Old 10-25-2010, 01:32 PM
Pipette Filler
Points: 689, Level: 13 Points: 689, Level: 13 Points: 689, Level: 13
Activity: 0% Activity: 0% Activity: 0%
 
Join Date: Sep 2010
Posts: 21
Thanks: 1
Thanked 0 Times in 0 Posts
Default Re: Primer Design

Does this region seems ok for Forward and reverse?

FP

ARTKAIE

RP

RDSMIGVS
Reply With Quote
  #7  
Old 02-20-2011, 07:16 AM
Pipette Filler
Points: 580, Level: 11 Points: 580, Level: 11 Points: 580, Level: 11
Activity: 0% Activity: 0% Activity: 0%
 
Join Date: Sep 2010
Location: Buenos Aires, Argentina
Posts: 7
Thanks: 0
Thanked 2 Times in 2 Posts
Default Re: Primer Design

Yep. They look pretty cool.
Now is my turn to apologize for the delay in getting back to you.

Have you had any advances in your cloning?

Regards,

Leo.
Reply With Quote
Reply

Tags
design , primer


Thread Tools
Display Modes

Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts

BB code is On
Smilies are On
[IMG] code is On
HTML code is Off
Trackbacks are On
Pingbacks are On
Refbacks are On

Forum Jump

Similar Threads
Thread Thread Starter Forum Replies Last Post
Can anyone help me to correct my primer design? confusing PCR - Polymerase Chain Reaction Forum 2 01-12-2010 09:12 PM
Can anyone help me to correct my primer design? confusing Bioinformatics 0 12-12-2009 11:21 AM
Bad primer design ? How can I know ? surt Bioinformatics 4 10-07-2009 07:24 AM
How to design primer? af malik PCR - Polymerase Chain Reaction Forum 3 01-29-2009 10:11 AM
Primer design software Josh Levin Protocols and Methods Forum 0 01-08-2009 01:31 PM


All times are GMT. The time now is 12:14 PM.


Powered by vBulletin® Version 3.8.4
Copyright ©2000 - 2013, Jelsoft Enterprises Ltd.
Copyright 2005 - 2012 Molecular Station | All Rights Reserved
Page generated in 0.20336 seconds with 16 queries