| | |||||||
| Register | Search | Today's Posts | Mark Forums Read |
| PCR - Polymerase Chain Reaction Forum PCR - Polymerase Chain Reaction Forum. Discuss and ask questions about PCR troubleshooting, PCR protocols and methods, PCR products, and PCR theory. |
| | LinkBack | Thread Tools | Display Modes |
|
#1
| |||||||||||
| |||||||||||
| I am trying to amplify a region for a strain tht has not been sequenced so far. I designed primers using the the sequence information of the conserved domain. The size of my amplicon expected is around 600bp. But, I was only able to amplify a 200bp product. The region tht was conserved was around the region between 120-480 bp. Can anyone suggest any other ways to design the primers ? thnx! |
|
#2
| |||||||||||
| |||||||||||
| Maybe you could design your primers inside the region that is well conserved, instead of using flanking regions? What´s your departure material? gDNA? cDNA? Is it a bacterial, yeast or viral gene you are trying to catch? |
|
#3
| |||||||||||
| |||||||||||
| I used gDNA as my template and used the inside region which was well conserved. It is a bacterial gene I am trying to catch.I have highlighted the conserved regions I used for my Forward and Reverse primer design. I am lost; any thoughts how how to get the complete gene amplified? gi 50593059 13 ARTKAIETLLYERGLITPAAVDRVVSYYENEIGPMGGAKVVAKSWVDPEYRKWLEEDATAAMASLGYAGEQAHQISAVFN 92 Cdd:TIGR01323 1 ARAKALEQVLKSKGLIPEGAVDQLTSLYENEWGPENGAKVVAKAWVDPEFRALLLKDATAACAQFGYTGPQGEYIVALEN 80 90 100 110 120 130 140 150 160 ....*....|....*....|....*....|....*....|....*....| ....*....|....*....|....*....| gi 50593059 93 DSQTHHVVVCTLCSCYPWPVLGLPPAWYKSMEYRSRVVADPRGVLkRDFG FDIPDEVEVRVWDSSSEIRYIVIPERPAGT 172 Cdd:TIGR01323 81 TPGVHNVVVCTLCSCYPWPVLGLPPEWYKGFEYRARLVRDPRGVL-REFGTELPSDVEIRVWDSSAESRYLVLPQRPAGT 159 170 180 ....*....|....*....|....*. gi 50593059 173 DGWSEDELAKLVSRDSMIGVSNALTP 198 Cdd:TIGR01323 160 EHMSEEQLQQLVTRDSLIGVSLPRTP 185 |
|
#4
| |||||||||||
| |||||||||||
| OK. According to the sequence you pasted, your amplicon should be around 372 bp (124 aminoacids*3), so I´m confused about you saying you should expect a 600 bp amplicon? Besides, now I see you are using degenerate primers (and since you lack nucleotide sequence info, these are REALLY degenerate). That could explain why you are getting an unexpected amplicon: it could be due to a simple mispriming. Several strategies could help in minimizing off-target amplification. These are:
Alternatively, you can redesign your primers. The 3´end of your forward primer looks quite nice. A lysine in the 3´end is a good deal: only two possible codons coding for it (i.e. fewer degeneration). But I still would have continued to the tryptophan (only one possible codon) to enhance specificity. Thus, the sequence to add to the 3´end of your current forward primer would be: DSIUGG (Ser/Ala + Trp). I think this could enhance your primer specificity a lot. With respect to the reverse primer, it looks like you´ve chosen many aminoacids with wide codon redundance. This greatly hampers your primer specificity. I would use the following region to design a reverse primer: gi 50593059 175 WSEDEL Cdd:TIGR01323 172 MSEEQL The REVERSE primer thus being: 5´-IARRTSITCYTCISWCKW-3´ I hope this helps at least a little. ![]() Good luck with your experiments. |
|
#5
| |||||||||||
| |||||||||||
| HI Irideus, Thank u very much. Sorry to get back late to ur posts though... will surely keep u updated. |
|
#6
| |||||||||||
| |||||||||||
| Does this region seems ok for Forward and reverse FP ARTKAIE RP RDSMIGVS |
|
#7
| |||||||||||
| |||||||||||
| Yep. They look pretty cool. Now is my turn to apologize for the delay in getting back to you. Have you had any advances in your cloning? Regards, Leo. |
| Tags |
| design , primer |
| Thread Tools | |
| Display Modes | |
|
|
| | ||||
| Thread | Thread Starter | Forum | Replies | Last Post |
| Can anyone help me to correct my primer design? | confusing | PCR - Polymerase Chain Reaction Forum | 2 | 01-12-2010 09:12 PM |
| Can anyone help me to correct my primer design? | confusing | Bioinformatics | 0 | 12-12-2009 11:21 AM |
| Bad primer design ? How can I know ? | surt | Bioinformatics | 4 | 10-07-2009 07:24 AM |
| How to design primer? | af malik | PCR - Polymerase Chain Reaction Forum | 3 | 01-29-2009 10:11 AM |
| Primer design software | Josh Levin | Protocols and Methods Forum | 0 | 01-08-2009 01:31 PM |