| |||||||
| Register | Search | Today's Posts | Mark Forums Read |
| Bioinformatics Have questions about bioinformatic tools or databases? Post questions here. Discuss and post interesting bioinformatics information. |
 |
| | LinkBack | Thread Tools | Display Modes |
|
#2
11-24-2011, 03:24 PM
| |||||||||||
| |||||||||||
 Re: Blast and fasta Actually there is no file format called BLAST, BLAST is an alignment tool. To make FASTA files, use the ">" symbol followed by the name of the sequence, and on the next line paste your sequence, and save the file with an extension .fasta eg : >exampleSequence YYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSA IPYIGTNLV EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGL TSDSDKIPFHPYYTIKDFLG  |
|
| Tags |
| blast , fasta |
| Thread Tools | |
| Display Modes | |
|
|
Similar Threads | ||||
| Thread | Thread Starter | Forum | Replies | Last Post |
| blast to fasta | JohnOD | Bioinformatics | 2 | 04-29-2010 05:56 AM |
| blast? | JohnOD | Bioinformatics | 2 | 03-05-2010 02:25 PM |
| what's the meaning of bioinformatics, global alignment, BLAST, FASTA, RAPD, | budi guo | Proteomics Forum | 0 | 10-28-2008 05:17 PM |
| Sequence alignment from BLAST output | Mark Nance | Protocols and Methods Forum | 1 | 09-17-2008 05:41 AM |
| Arabidopsis FASTA files with MPSS data | Marta Matvienko | Arabidopsis and Plant Biology | 0 | 02-10-2004 10:41 PM |
Linear Mode
