Go Back   Science Forums Biology Forum Molecular Biology Forum Physics Chemistry Forum > Molecular Research Topics Forum > Bioinformatics
Register Search Today's Posts Mark Forums Read

Bioinformatics Have questions about bioinformatic tools or databases? Post questions here. Discuss and post interesting bioinformatics information.


Blast and fasta

Blast and fasta - Bioinformatics

Blast and fasta - Have questions about bioinformatic tools or databases? Post questions here. Discuss and post interesting bioinformatics information.


Reply
 
LinkBack Thread Tools Display Modes
  #1  
Old 10-26-2011, 10:06 PM
Pipette Filler
Points: 506, Level: 10 Points: 506, Level: 10 Points: 506, Level: 10
Activity: 0% Activity: 0% Activity: 0%
 
Join Date: Oct 2011
Posts: 20
Thanks: 0
Thanked 0 Times in 0 Posts
Default Blast and fasta



HI,
I would like to know how make my sequences with BLAST OR FASTA format?
Reply With Quote
  #2  
Old 11-24-2011, 03:24 PM
Pipette Filler
Points: 2, Level: 1 Points: 2, Level: 1 Points: 2, Level: 1
Activity: 0% Activity: 0% Activity: 0%
 
Join Date: Nov 2011
Posts: 1
Thanks: 0
Thanked 0 Times in 0 Posts
Default Re: Blast and fasta

Actually there is no file format called BLAST, BLAST is an alignment tool.
To make FASTA files, use the ">" symbol followed by the name of the sequence, and on the next line paste your sequence, and save the file with an extension .fasta

eg :

>exampleSequence
YYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSA IPYIGTNLV
EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGL TSDSDKIPFHPYYTIKDFLG
Reply With Quote
Reply

Tags
blast , fasta


Thread Tools
Display Modes

Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts

BB code is On
Smilies are On
[IMG] code is On
HTML code is Off
Trackbacks are On
Pingbacks are On
Refbacks are On

Forum Jump

Similar Threads
Thread Thread Starter Forum Replies Last Post
blast to fasta JohnOD Bioinformatics 2 04-29-2010 05:56 AM
blast? JohnOD Bioinformatics 2 03-05-2010 02:25 PM
what's the meaning of bioinformatics, global alignment, BLAST, FASTA, RAPD, budi guo Proteomics Forum 0 10-28-2008 05:17 PM
Sequence alignment from BLAST output Mark Nance Protocols and Methods Forum 1 09-17-2008 05:41 AM
Arabidopsis FASTA files with MPSS data Marta Matvienko Arabidopsis and Plant Biology 0 02-10-2004 10:41 PM


All times are GMT. The time now is 06:16 PM.


Powered by vBulletin® Version 3.8.4
Copyright ©2000 - 2013, Jelsoft Enterprises Ltd.
Copyright 2005 - 2012 Molecular Station | All Rights Reserved
Page generated in 0.17020 seconds with 16 queries