Parse error: syntax error, unexpected '=' in /home/molec2/public_html/forum/archive/index.php(267) : eval()'d code on line 6

Parse error: syntax error, unexpected '=' in /home/molec2/public_html/forum/archive/index.php(475) : eval()'d code on line 5
Peptide Forum [Archive] - Molecular Biology Forum Life Science Forums
PDA

View Full Version : Peptide Forum

  1. What is a peptide bond?
  2. Can the bond between proline's amine end with another amino acid be called a peptide
  3. Please help: If a peptide occurs in one of your cells that is 50 amino acids long...?
  4. Double stranded DNA sequence show a gene encoding a small peptide.The...
  5. Out of aldosterone, angiotensin II, antidiuretic hormone, and atrial...
  6. Peptide synthesis in the solid phase?
  7. 10 points best answer! Compare and Contrast steroid and peptide hormones.?
  8. How many peptide bonds in this protein molecule?
  9. How does ERAP-1 know to trim peptides longer than 8-9 amino acids in antigen
  10. Peptide bond, plz help?
  11. cleavage of the trityl group
  12. why is a peptide bond stronger than an ester bond?
  13. Are there any natural sources of orexin peptides?
  14. The peptide bond joining amino acids into proteins is a specific example of...
  15. The N-terminal amino acid in the peptide ala-leu-gly-his-pro is?
  16. when two alpha-amino acids bond together to form a peptide bond, what...
  17. Can anyone explain me VERY clearly how to calculate the PI of the
  18. How many peptide bonds does GLUT1 have?
  19. Peptide formation in human hair.?
  20. Atrial Natriuretic Peptide (ANP hormone) question?
  21. How to determine a peptide concentration?
  22. Synthesis of a fat and formation of a peptide bond?
  23. Asking about Agarose gel concentration
  24. The formation of a peptide bond involves...?
  25. How do you find a peptide bond?
  26. How do i determine the net charge on a peptide?
  27. How do peptides work for fat loss?
  28. Determine the isoelectric point for the peptide?
  29. C-Peptide Test Results..Confused.?
  30. why does chymotrypsin and trypsin break peptide bonds between different amino acids?
  31. Peptide help!!!!!!!!!!?
  32. Serine linked with peptide bonds?
  33. Predicting net charges on peptides?
  34. Which of the following is NOT true about peptides?
  35. Peptide bond formation in vitro vs in vivo?
  36. What are the sequences of the peptides for the following problem?
  37. What are the sequences of the peptides for the following problem?
  38. main differences between solid and solution phase peptide synthesis?
  39. What occurs when a peptide bond forms between two amino acids?
  40. What occurs when a peptide bond forms between two amino acids?
  41. peptide bonds hold together what kinds of molecules?
  42. for penta-peptide how can wedetermine the structural characteristics the
  43. Peptide and genes question 10 pts?
  44. Peptide synthesizer recommendations?
  45. Is the formation of "intramolecular peptide bond" in a amino acid molecule possible?
  46. What is Atrial natriuretic peptide? HELP!?
  47. How is a peptide formed?
  48. Tfmsa
  49. From the data given below, deduce the amino acid sequence of the peptide.?
  50. Which of the following is a function of a signal peptide?
  51. Determining net charge of a peptide at pH 4?
  52. Proteins r broken down further to peptides by enzymes called .... . .........
  53. If a protein contained 200 peptide bonds, how many molecules of water do
  54. Which of the following is a function of a signal peptide?
  55. How to clone a gene coding for a peptide?
  56. What is the net charge of a Peptide?
  57. Determine the amino acid sequence of a peptide using the following information:?
  58. Biology- peptides and cloning them?
  59. Why does a peptide bond not allow freely rotating peptide chains?
  60. CKDDVFTHLYTLIVKPDNTYQVKIDNEVVEKGELEK . How many peptide bonds are present
  61. How do you identify the anitmicrobial peptide present in the skin gland...
  62. What are ionic, covalent, and peptide bonds?
  63. What are the different techniques are there in peptide synthesis such N-
  64. How to clean up protein/peptides for RP-HPLC.?
  65. So if there are 199 amino acids in a protein, how many peptide bonds would there be?
  66. Peptides completely dissolved?
  67. Where can pro-insulin and C-peptide be checked?
  68. Anyone know anything about a C-Peptide test?
  69. ehter precipitation
  70. In which part of translation is f-Met used to begin a peptide chain as the first...
  71. structure of peptide formed from reaction of acid group glycine and amine group
  72. Procedure for Labeling Peptide with radioisotope?
  73. what it means when it said that peptide bond is planar and all in trans...
  74. Muscle Peptides / Heart rate?
  75. why are peptide bonds planar and rigid?
  76. Has any one ever used a stretch mark cream that has copper peptides, Emu oil...
  77. The cleaving of peptide bonds is performed by proteins called........?
  78. Desmopressin Acetate
  79. dermatology: is an amino-peptide serum like olay's regenerist safe to use after a...
  80. Is elitepeptides.com the cheapest source for peptides?
  81. Predict the direction of migration of peptide in direct current?
  82. peptide direction of migration in direct current?
  83. what is peptide direction of migration in direct current?
  84. What is the difference between Peptide synthesis and regular organic compound
  85. regading blocking of amplified DNA in the gel wells during gel electrophoresis
  86. Help! Cleavage mixture accident!
  87. Is low c-peptide always an indication of type 1 diabetes?
  88. How to calculate the net charge of the peptide Arg-Phe-Gly-Lys-Glu at pH7?
  89. C-peptide test? What is normal?
  90. Which element is involved in the peptide bond, which links amino acids?
  91. Which bio molecule contains a peptide bond?
  92. Chromatography question
  93. Peptide hydrolysis acidic and basic?
  94. Of proteins and peptide bonds.?
  95. what is a spacer sequence in a peptide?
  96. Amine vs. peptide neurotransmitters?
  97. What are some root crops or legumes containing bioactive peptides that...
  98. Peptide purification.
  99. When atoms “share” electrons, a(n) __________ bond is formed. ionic covalent peptide?
  100. resins for peptide synthesis.
  101. A peptide bond is present in ?
  102. The difference between each type of amino acid is the peptide bond between
  103. a. The amino acid composition of the C-terminal peptide 2 His residues. What is the
  104. Peptide questions
  105. GL Biochem acquired Commonwealth Biotechnologies
  106. Where can I buy silk peptide powder in the Scarborough/Toronto area?
  107. Need help on peptide solubility and MIC test?
  108. What is an antigenic peptide?
  109. 13 year old girl, high c- peptide level and rash on nap of neck, excesive weight...
  110. Is Gastric Inhibitory Peptide and Enterogastrone the same thing?
  111. difference between a protein and peptide hormone?
  112. Are copper peptides the cure all in skin?
  113. Structure of LY-548806
  114. Methods for storing uncompleted peptide synthesis
  115. Looking for LC/MS/MS for peptide analysis
  116. Biotin-PEG resin
  117. CBL now in the US
  118. Fmoc protected amino acids used in the SPPS
  119. what rapid coupling protocols do you use?
  120. cleavage of merrifield resin
  121. peptide design
  122. Protein structure prediction Problem
  123. Peptide storage in the field
  124. Resins for Solid Phase Peptide Synthesis
  125. Identifying insect precursor processing sites
  126. peptide synthesis of MCOT-II cyclotide
  127. Peptide Synthesis Reagents
  128. Peptide Synthesis Kaiser Test HELP
  129. Peptide Synthesis Kaiser Test Question
  130. about the Ac deprotection
  131. Custom Peptide Synthesis Company
  132. maldi tof spectera interpratation
  133. Peptide crosslinking
  134. synthetic peptide purification , help
  135. protocol for solution phase peptide synthesis
  136. need help understanding what n and c terminus on hHGRH(1-29)
  137. PEGMGF sequence?
  138. Biology... a hypothetical problem (peptide diet)?
  139. What are peptide hormones?
  140. Is it a steroid, gas, amine, peptide or protein?
  141. Draw tripeptide w/ serine, cysteine, and aspartic acid, showing peptide...
  142. Amino Acids Combined By Peptide Bonds?
  143. Peptide Prices
  144. HF cleavage
  145. How to check peptide aggregation in solution?
  146. How to change from peptide-trifluoroacetate to peptide-acetate?
  147. Boc chemistry
  148. Peptide analysis
  149. Cobas Amplicor protocol for HCV
  150. Fmoc removal from cleaved peptide
  151. benzyl protected aa
  152. The Tfa Problem
  153. cleavage and deprotection of peptide
  154. Analysis of crude peptide
  155. Peptide synthesis Labs in USA universities for Phd
  156. Folding of AK Helical Peptides
  157. Peptide Folding
  158. Glutamic acid
  159. 2-CTC or Wang LL resin?
  160. Hctu
  161. capping
  162. Multiple Antigenic Peptide systems
  163. dimer-homodimer-heterodimer
  164. Intramolecular lactame bridge (Asp-Lys)
  165. Poor coupling
  166. HBr in acetic acid
  167. Amide-group quantitation
  168. Amide-group quantitation
  169. Methods for quantatitive measurement of free amide group during coupling of SPPS
  170. Methods for quantitatitive measurement of free amide group in coupling step of SPPS
  171. Chlorotoxin
  172. Heart Hormones eliminate Human Cancer
  173. Poor reproducibility during peptide synthesis
  174. Peptides containing tryptophan give pink powder
  175. Fmoc-amino acids
  176. Difficult Sequences
  177. Resin Re-Swelling
  178. Magic Mixture
  179. How to determine the noncovalent binding peptides (hexamer)by MS?
  180. which company's resin is better for peptide synthesis
  181. Peptide Job or post doc opportunity!!!
  182. a question on Abeta petide
  183. cyclic peptide
  184. Search Analyze Peptide Sequence Using ID and Peptide Sequence
  185. Which country is the best for doing post doc in peptide chemistry
  186. PNA supply company
  187. Peptide sequencing from old SDS PAGE gel
  188. smallest working peptide
  189. Protected Amino Acid
  190. Peptide Synthesis for Antibodies - Tips Before Ordering!
  191. hello all
  192. amino complex free form and peptide bonded amino
  193. I need a peptide chain that can be used instead of...
  194. What are the 5 ways Atrial Natiuretic
  195. Can C-peptide level go up?very important?
  196. Any one heard of OHT Peptide 3?for under
  197. why is peptide bond is called to be
  198. a peptide bond is formed how?
  199. Peaks Software Trial
  200. making free base of a peptide
  201. beta sheet peptide purification
  202. Protein purification
  203. Arginine Containing Peptides
  204. Lactam reaction causes +85 MW side product
  205. how to synthesize Goserelin？
  206. disulfide cleavage
  207. Cyclization on Resin
  208. Reducer in Cleavage cocktail
  209. 2D PAGE problem
  210. Future Applications of Peptides in Research
  211. Using Peptides for Affinity Purification
  212. Peptide Aldehyde Synthesis and Purification
  213. EDT extraction and isolation from peptide cleavage mixture
  214. Peptide Glycosylation
  215. Do you need Peptides and Relative Products with most competitive Price?
  216. What Means by "Equivalent"
  217. Handling Peptides - Tips
  218. Peptide Synthesis
  219. Peptide Modifications
  220. Peptide Protection Groups
  221. Peptide Cleavage
  222. Peptide Purification
  223. New Peptide Forum Open!
  224. Custom Peptide Synthesis and Price?
  225. Peptide Station: A New Molecular Station Site
  226. Peptide Fragment Identification